PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BS_2CB91C54A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 390aa    MW: 42253.2 Da    PI: 6.8855
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BS_2CB91C54A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.3e-153279148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g W++eEde+lv +  + G g+W+ +ar  g+ R++k+c++rw +yl
  Traes_5BS_2CB91C54A.1 32 KGLWSPEEDERLVAYMLRSGQGSWSDVARNAGLQRCGKSCRLRWINYL 79
                           678*******************************************97 PP

2Myb_DNA-binding51.62.1e-1685128146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg+++++E++l+v++++ lG++ W+ Ia++++ gRt++++k++w++
  Traes_5BS_2CB91C54A.1  85 RGAFSPQEEDLIVNLHAILGNR-WSQIAARLP-GRTDNEIKNFWNS 128
                            89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.1492779IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-222882IPR009057Homeodomain-like
SuperFamilySSF466891.68E-2830126IPR009057Homeodomain-like
SMARTSM007172.1E-103181IPR001005SANT/Myb domain
PfamPF002492.9E-133279IPR001005SANT/Myb domain
CDDcd001678.57E-93579No hitNo description
PROSITE profilePS5129424.97180134IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2583134IPR009057Homeodomain-like
SMARTSM007171.3E-1584132IPR001005SANT/Myb domain
PfamPF002496.9E-1585128IPR001005SANT/Myb domain
CDDcd001673.33E-1187127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MRKPVECPAT KCSGGAAPGN SNVAAAAAKL RKGLWSPEED ERLVAYMLRS GQGSWSDVAR  60
NAGLQRCGKS CRLRWINYLR PDLKRGAFSP QEEDLIVNLH AILGNRWSQI AARLPGRTDN  120
EIKNFWNSTI KKRLKMNSAA SSPATTECAS PPEPKLDGGS ASCLDLTSLE DGSHHGMKSM  180
WRIDSSSSPS SSSSIQQQSR PSTMAPAANR GYGGLLLPLP NQFCGVAPST DTSVPPFFHD  240
HSSFKQVSPL RTGGYYPHGM AMERGGGSCF TGEEAVGGGG EHSVLFNVPP LLEPMAVTLQ  300
DQTLMAATGN SDDNHRNINS TAEGTTLSSK NGCNINDDNN SKNNINSVVS YWEQHGHQQH  360
MSRNVVMGEW DLEELMKDVS CLPFLDFQVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-282913424128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6720680.0AY672068.1 Hordeum vulgare subsp. vulgare myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575963.11e-160PREDICTED: myb-related protein Zm38
TrEMBLW5FLJ70.0W5FLJ7_WHEAT; Uncharacterized protein
STRINGMLOC_66577.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98213545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.13e-65myb domain protein 46
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]